PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa11g013560.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HB-PHD
Protein Properties Length: 840aa    MW: 94557.4 Da    PI: 4.5585
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa11g013560.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox34.92.5e-11462506953
                     HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
        Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                     k  +e L ++F++n  ps++ r +L+k+l+L+ ++V+ WF+N R+
  Csa11g013560.1 462 KAAVEKLRKVFAENELPSKDVRDRLSKELSLDPEKVSKWFKNTRY 506
                     677899*************************************97 PP

2PHD41.82.5e-14194249151
                     SBTTTSS..TCTTSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCd.gCkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ C++  +  +++++lCd +C+++fH+kCl+++le+e++p g   w+C+ C++k
  Csa11g013560.1 194 FCAECNSreAFPDNDIILCDgTCNRAFHQKCLDPPLETESIPPGdqGWFCKFCDCK 249
                     6999***55455********56********************9999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579032.88E-14186251IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.102.2E-12190249IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.976192249IPR019787Zinc finger, PHD-finger
PfamPF006281.7E-11194249IPR019787Zinc finger, PHD-finger
SMARTSM002497.7E-10194247IPR001965Zinc finger, PHD-type
CDDcd155043.69E-31194246No hitNo description
PROSITE patternPS013590195246IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.601.6E-12445505IPR009057Homeodomain-like
SuperFamilySSF466894.11E-11450515IPR009057Homeodomain-like
PROSITE profilePS5007113.297451511IPR001356Homeobox domain
SMARTSM003892.2E-12453515IPR001356Homeobox domain
CDDcd000867.57E-10454515No hitNo description
PfamPF000469.0E-9462506IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 840 aa     Download sequence    Send to blast
MEESEAKGRI RRETEKACVS VERIGSTLLS SLAKKGKETS NKRNPKPNKR KAEEEICSKS  60
RNKKCTRGRV HCEEEEEEEE KGKKTRKRKS KRQQKDNKVE VDDSLRLQRR TRYLLIKMKM  120
QQNLIDAYAT EGWKGQSREK IRPDKELERA RKEILNCKLG LRDAIRQLDL LSSVGSMEDK  180
VIALDGSIHH DHIFCAECNS REAFPDNDII LCDGTCNRAF HQKCLDPPLE TESIPPGDQG  240
WFCKFCDCKM EIIDTMNAQI GTHFPADSNW QDIFKEEASL PIGSKATVNN EADWPSDDSK  300
DDDYDPEMRE NGGGSSSNVS GGGGDDNDGE SISTSLSSDG VALSTGSWEG HGFNNMVEHC  360
ETSNEETVCG PRQRRTVDYT KLYYEMFGKD AGLQEQGSED EDWGPNDRRK RRKESDVTSE  420
LVNMCESSKK DQDAVQIPAQ RERASVSVEN KGGRRPMFRL PKAAVEKLRK VFAENELPSK  480
DVRDRLSKEL SLDPEKVSKW FKNTRYMALR NRKMESEKQP EHSKTVSGRD SGPEAVMKNN  540
TDTKHAQNTL DETVPPGFND SATNQKTISP CNNNQEVPED LKTVSGGDSG DSGPEAVMEN  600
DTNEVQDSLD ETFPPGFNDL ATNQKIYSPC NNSPEIPEDL KTVSGGDSEP EAVMENDTNE  660
VQDSLDETFP PGFNDLAANQ KILAPCNNNQ EETQQANVSF PAPTDEMQQY LEQNDSSFAL  720
VPHEELSSEM SLKTAVEEKE TEIKTTEEPH EVLSSEMSLE TAEEEEETES KITEEEEYEA  780
VMEMLCRTEN KLLDVTQRLE RFKTPKGRKK LGKCSSSLSE EDSVVYVPIV EIMEKKENN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18489TRKRKS
2408413RKRRKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATHPRHA0.0L21991.1 Arabidopsis thaliana homeodomain protein (PRHA) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010438239.10.0PREDICTED: pathogenesis-related homeodomain protein isoform X1
SwissprotP487850.0PRH_ARATH; Pathogenesis-related homeodomain protein
TrEMBLR0F3V50.0R0F3V5_9BRAS; Uncharacterized protein
STRINGAT4G29940.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86992738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.10.0pathogenesis related homeodomain protein A